General Information

  • ID:  hor002004
  • Uniprot ID:  P51925
  • Protein name:  GnRH-associated peptide 2
  • Gene name:  gnrh2
  • Organism:  Sparus aurata (Gilthead sea bream)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sparus (genus), Sparidae (family), Spariformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  ELDSFGTSEISEEIKLCEAGECSYLTPQRRSVLRNILLDALARELQKRK
  • Length:  49
  • Propeptide:  MCVSRLVLLLGLLLCVGAQLSNGQHWSHGWYPGGKRELDSFGTSEISEEIKLCEAGECSYLTPQRRSVLRNILLDALARELQKRK
  • Signal peptide:  MCVSRLVLLLGLLLCVGAQLSNG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51925-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002004_AF2.pdbhor002004_ESM.pdb

Physical Information

Mass: 646675 Formula: C241H404N70O79S2
Absent amino acids: HMW Common amino acids: L
pI: 4.98 Basic residues: 8
Polar residues: 13 Hydrophobic residues: 16
Hydrophobicity: -48.98 Boman Index: -12535
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 99.59
Instability Index: 9557.35 Extinction Coefficient cystines: 1615
Absorbance 280nm: 33.65

Literature

  • PubMed ID:  7991588
  • Title:  Three forms of gonadotropin-releasing hormone characterized from brains of one species.